Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of PRDX1 monoclonal antibody (M01), clone 4B11-D10
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | WB-Ce,S-ELISA,ELISA |
More info about PRDX1 monoclonal antibody (M01), clone 4B11-D10
| Brand: | Abnova |
| Reference: | H00005052-M01 |
| Product name: | PRDX1 monoclonal antibody (M01), clone 4B11-D10 |
| Product description: | Mouse monoclonal antibody raised against a full length recombinant PRDX1. |
| Clone: | 4B11-D10 |
| Isotype: | IgG1 Kappa |
| Gene id: | 5052 |
| Gene name: | PRDX1 |
| Gene alias: | MSP23|NKEFA|PAG|PAGA|PAGB|PRX1|PRXI|TDPX2 |
| Gene description: | peroxiredoxin 1 |
| Genbank accession: | BC007063 |
| Immunogen: | PRDX1 (AAH07063, 1 a.a. ~ 199 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | MSSGNAKIGHPAPNFKATAVMPDGQFKDISLSDYKGKYVVFFFHPLDFTFVCPTEIIAFSDRAEEFKKLNCQVIGASVDSHFCHLAWVNTPKKQGGLGPMNIPLVSDPKRTIAQDYGVLKADEGISFRGLFIIDDKGILRQITVNDLPVGRSVDETLRLVQAFQFTDKHGEVCPAGWKPGSDTIKPDVQKSKEYFSKQK |
| Protein accession: | AAH07063 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | PRDX1 monoclonal antibody (M01), clone 4B11-D10 Western Blot analysis of PRDX1 expression in HeLa ( Cat # L013V1 ). |
| Applications: | WB-Ce,S-ELISA,ELISA |
| Shipping condition: | Dry Ice |
| Publications: | Peroxiredoxin 1 expression in active ulcerative colitis mucosa identified by proteome analysis and involvement of thioredoxin based on immunohistochemistry.Horie K, Mikami T, Yoshida T, Sato Y, Okayasu I. Oncol Lett. 2018 Feb;15(2):2364-2372. doi: 10.3892/ol.2017.7549. Epub 2017 Dec 8. |