Cart 3 Product Products 897,00 € (empty)
No products
To be determined Shipping
897,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 3 items in your cart. There is 1 item in your cart.
Total products (tax excl.) 897,00 €
Total shipping (tax excl.) To be determined
Total (tax excl.) 897,00 €
Data sheet of PAFAH2 purified MaxPab rabbit polyclonal antibody (D01P)
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Rabbit |
| Applications | WB-Ti,WB-Tr |
More info about PAFAH2 purified MaxPab rabbit polyclonal antibody (D01P)
| Brand: | Abnova |
| Reference: | H00005051-D01P |
| Product name: | PAFAH2 purified MaxPab rabbit polyclonal antibody (D01P) |
| Product description: | Rabbit polyclonal antibody raised against a full-length human PAFAH2 protein. |
| Gene id: | 5051 |
| Gene name: | PAFAH2 |
| Gene alias: | FLJ26025|HSD-PLA2 |
| Gene description: | platelet-activating factor acetylhydrolase 2, 40kDa |
| Genbank accession: | NM_000437.2 |
| Immunogen: | PAFAH2 (NP_000428.2, 1 a.a. ~ 392 a.a) full-length human protein. |
| Immunogen sequence/protein sequence: | MGVNQSVGFPPVTGPHLVGCGDVMEGQNLQGSFFRLFYPCQKAEETMEQPLWIPRYEYCTGLAEYLQFNKRCGGLLFNLAVGSCRLPVSWNGPFKTKDSGYPLIIFSHGLGAFRTLYSAFCMELASRGFVVAVPEHRDRSAATTYFCKQAPEENQPTNESLQEEWIPFRRVEEGEKEFHVRNPQVHQRVSECLRVLKILQEVTAGQTVFNILPGGLDLMTLKGNIDMSRVAVMGHSFGGATAILALAKETQFRCAVALDAWMFPLERDFYPKARGPVFFINTEKFQTMESVNLMKKICAQHEQSRIITVLGSVHRSQTDFAFVTGNLIGKFFSTETRGSLDPYEGQEVMVRAMLAFLQKHLDLKEDYNQWNNLIEGIGPSLTPGAPHHLSSL |
| Protein accession: | NP_000428.2 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody reactive against mammalian transfected lysate. |
| Product type: | Primary antibodies |
| Host species: | Rabbit |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | Western Blot analysis of PAFAH2 expression in transfected 293T cell line (H00005051-T01) by PAFAH2 MaxPab polyclonal antibody. Lane 1: PAFAH2 transfected lysate(44.00 KDa). Lane 2: Non-transfected lysate. |
| Applications: | WB-Ti,WB-Tr |
| Shipping condition: | Dry Ice |