PAFAH2 MaxPab mouse polyclonal antibody (B01) View larger

PAFAH2 MaxPab mouse polyclonal antibody (B01)

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of PAFAH2 MaxPab mouse polyclonal antibody (B01)

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsWB-Tr

More info about PAFAH2 MaxPab mouse polyclonal antibody (B01)

Brand: Abnova
Reference: H00005051-B01
Product name: PAFAH2 MaxPab mouse polyclonal antibody (B01)
Product description: Mouse polyclonal antibody raised against a full-length human PAFAH2 protein.
Gene id: 5051
Gene name: PAFAH2
Gene alias: FLJ26025|HSD-PLA2
Gene description: platelet-activating factor acetylhydrolase 2, 40kDa
Genbank accession: NM_000437.2
Immunogen: PAFAH2 (NP_000428.2, 1 a.a. ~ 392 a.a) full-length human protein.
Immunogen sequence/protein sequence: MGVNQSVGFPPVTGPHLVGCGDVMEGQNLQGSFFRLFYPCQKAEETMEQPLWIPRYEYCTGLAEYLQFNKRCGGLLFNLAVGSCRLPVSWNGPFKTKDSGYPLIIFSHGLGAFRTLYSAFCMELASRGFVVAVPEHRDRSAATTYFCKQAPEENQPTNESLQEEWIPFRRVEEGEKEFHVRNPQVHQRVSECLRVLKILQEVTAGQTVFNILPGGLDLMTLKGNIDMSRVAVMGHSFGGATAILALAKETQFRCAVALDAWMFPLERDFYPKARGPVFFINTEKFQTMESVNLMKKICAQHEQSRIITVLGSVHRSQTDFAFVTGNLIGKFFSTETRGSLDPYEGQEVMVRAMLAFLQKHLDLKEDYNQWNNLIEGIGPSLTPGAPHHLSSL
Protein accession: NP_000428.2
Storage buffer: No additive
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody reactive against mammalian transfected lysate.
Note: For IHC and IF applications, antibody purification with Protein A will be needed prior to use.
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00005051-B01-13-15-1.jpg
Application image note: Western Blot analysis of PAFAH2 expression in transfected 293T cell line (H00005051-T01) by PAFAH2 MaxPab polyclonal antibody.

Lane 1: PAFAH2 transfected lysate(43.12 KDa).
Lane 2: Non-transfected lysate.
Applications: WB-Tr
Shipping condition: Dry Ice

Reviews

Buy PAFAH2 MaxPab mouse polyclonal antibody (B01) now

Add to cart