Cart 18 Product Products 6 886,22 € (empty)
-
-
-
-
-
-
-
-
-
-
-
-
1 x Mouse...240,00 € -
-
-
-
-
-
No products
To be determined Shipping
6 886,22 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 18 items in your cart. There is 1 item in your cart.
Total products (tax excl.) 6 886,22 €
Total shipping (tax excl.) To be determined
Total (tax excl.) 6 886,22 €
Data sheet of PAFAH1B3 monoclonal antibody (M08), clone 3G6
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human,Mouse,Rat |
| Host species | Mouse |
| Applications | WB-Ce,S-ELISA,ELISA,WB-Re |
More info about PAFAH1B3 monoclonal antibody (M08), clone 3G6
| Brand: | Abnova |
| Reference: | H00005050-M08 |
| Product name: | PAFAH1B3 monoclonal antibody (M08), clone 3G6 |
| Product description: | Mouse monoclonal antibody raised against a full-length recombinant PAFAH1B3. |
| Clone: | 3G6 |
| Isotype: | IgG2b Kappa |
| Gene id: | 5050 |
| Gene name: | PAFAH1B3 |
| Gene alias: | - |
| Gene description: | platelet-activating factor acetylhydrolase, isoform Ib, gamma subunit 29kDa |
| Genbank accession: | BC003016 |
| Immunogen: | PAFAH1B3 (AAH03016, 1 a.a. ~ 231 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | MSGEENPASKPTPVQDVQGDGRWMSLHHRFVADSKDKEPEVVFIGDSLVQLMHQCEIWRELFSPLHALNFGIGGDGTQHVLWRLENGELEHIRPKIVVVWVGTNNHGHTAEQVTGGIKAIVQLVNERQPQARVVVLGLLPRGQHPNPLREKNRQVNELVRAALAGHPRAHFLDADPGFVHSDGTISHHDMYDYLHLSRLGYTPVCRALHSLLLRLLAQDQGQGAPLLEPAP |
| Protein accession: | AAH03016 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (51.15 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human,Mouse,Rat |
| Application image: |  |
| Application image note: | PAFAH1B3 monoclonal antibody (M08), clone 3G6. Western Blot analysis of PAFAH1B3 expression in IMR-32 ( Cat # L008V1 ). |
| Applications: | WB-Ce,S-ELISA,ELISA,WB-Re |
| Shipping condition: | Dry Ice |