PAFAH1B3 MaxPab mouse polyclonal antibody (B01) View larger

PAFAH1B3 MaxPab mouse polyclonal antibody (B01)

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of PAFAH1B3 MaxPab mouse polyclonal antibody (B01)

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsWB-Ti,WB-Tr

More info about PAFAH1B3 MaxPab mouse polyclonal antibody (B01)

Brand: Abnova
Reference: H00005050-B01
Product name: PAFAH1B3 MaxPab mouse polyclonal antibody (B01)
Product description: Mouse polyclonal antibody raised against a full-length human PAFAH1B3 protein.
Gene id: 5050
Gene name: PAFAH1B3
Gene alias: -
Gene description: platelet-activating factor acetylhydrolase, isoform Ib, gamma subunit 29kDa
Genbank accession: NM_002573
Immunogen: PAFAH1B3 (NP_002564.1, 1 a.a. ~ 231 a.a) full-length human protein.
Immunogen sequence/protein sequence: MSGEENPASKPTPVQDVQGDGRWMSLHHRFVADSKDKEPEVVFIGDSLVQLMHQCEIWRELFSPLHALNFGIGGDGTQHVLWRLENGELEHIRPKIVVVWVGTNNHGHTAEQVTGGIKAIVQLVNERQPQARVVVLGLLPRGQHPNPLREKNRQVNELVRAALAGHPRAHFLDADPGFVHSDGTISHHDMYDYLHLSRLGYTPVCRALHSLLLRLLAQDQGQGAPLLEPAP
Protein accession: NP_002564
Storage buffer: No additive
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody reactive against mammalian transfected lysate.
Note: For IHC and IF applications, antibody purification with Protein A will be needed prior to use.
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00005050-B01-2-A0-1.jpg
Application image note: PAFAH1B3 MaxPab polyclonal antibody. Western Blot analysis of PAFAH1B3 expression in human kidney.
Applications: WB-Ti,WB-Tr
Shipping condition: Dry Ice

Reviews

Buy PAFAH1B3 MaxPab mouse polyclonal antibody (B01) now

Add to cart