No products
Prices are tax excluded
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | WB-Ti,ELISA |
| Brand: | Abnova |
| Reference: | H00005049-M01A |
| Product name: | PAFAH1B2 monoclonal antibody (M01A), clone 2F4-1C10 |
| Product description: | Mouse monoclonal antibody raised against a full-length recombinant PAFAH1B2. |
| Clone: | 2F4-1C10 |
| Isotype: | IgM Kappa |
| Gene id: | 5049 |
| Gene name: | PAFAH1B2 |
| Gene alias: | - |
| Gene description: | platelet-activating factor acetylhydrolase, isoform Ib, beta subunit 30kDa |
| Genbank accession: | BC000398 |
| Immunogen: | PAFAH1B2 (AAH00398, 1 a.a. ~ 229 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | MSQGDSNPAAIPHAAEDIQGDDRWMSQHNRFVLDCKDKEPDVLFVGDSMVQLMQQYEIWRELFSPLHALNFGIGGDTTRHVLWRLKNGELENIKPKVIVVWVGTNNHENTAEEVAGGIEAIVQLINTRQPQAKIIVLGLLPRGEKPNPLRQKNAKVNQLLKVSLPKLANVQLLDTDGGFVHSDGAISCHDMFDFLHLTGGGYAKICKPLHELIMQLLEETPEEKQTTIA |
| Protein accession: | AAH00398 |
| Storage buffer: | In ascites fluid |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: | ![]() |
| Quality control testing picture note: | Western Blot detection against Immunogen (50.93 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: | ![]() |
| Application image note: | PAFAH1B2 monoclonal antibody (M01A), clone 2F4-1C10. Western Blot analysis of PAFAH1B2 expression in human kidney. |
| Applications: | WB-Ti,ELISA |
| Shipping condition: | Dry Ice |