Brand: | Abnova |
Reference: | H00005049-M01A |
Product name: | PAFAH1B2 monoclonal antibody (M01A), clone 2F4-1C10 |
Product description: | Mouse monoclonal antibody raised against a full-length recombinant PAFAH1B2. |
Clone: | 2F4-1C10 |
Isotype: | IgM Kappa |
Gene id: | 5049 |
Gene name: | PAFAH1B2 |
Gene alias: | - |
Gene description: | platelet-activating factor acetylhydrolase, isoform Ib, beta subunit 30kDa |
Genbank accession: | BC000398 |
Immunogen: | PAFAH1B2 (AAH00398, 1 a.a. ~ 229 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | MSQGDSNPAAIPHAAEDIQGDDRWMSQHNRFVLDCKDKEPDVLFVGDSMVQLMQQYEIWRELFSPLHALNFGIGGDTTRHVLWRLKNGELENIKPKVIVVWVGTNNHENTAEEVAGGIEAIVQLINTRQPQAKIIVLGLLPRGEKPNPLRQKNAKVNQLLKVSLPKLANVQLLDTDGGFVHSDGAISCHDMFDFLHLTGGGYAKICKPLHELIMQLLEETPEEKQTTIA |
Protein accession: | AAH00398 |
Storage buffer: | In ascites fluid |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (50.93 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: |  |
Application image note: | PAFAH1B2 monoclonal antibody (M01A), clone 2F4-1C10. Western Blot analysis of PAFAH1B2 expression in human kidney. |
Applications: | WB-Ti,ELISA |
Shipping condition: | Dry Ice |