Cart 11 Product Products 19 472,60 € (empty)
No products
To be determined Shipping
19 472,60 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 11 items in your cart. There is 1 item in your cart.
Total products (tax excl.) 19 472,60 €
Total shipping (tax excl.) To be determined
Total (tax excl.) 19 472,60 €
Data sheet of PAFAH1B1 monoclonal antibody (M03), clone 5A5
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | IF,S-ELISA,ELISA,WB-Re,WB-Tr |
More info about PAFAH1B1 monoclonal antibody (M03), clone 5A5
| Brand: | Abnova |
| Reference: | H00005048-M03 |
| Product name: | PAFAH1B1 monoclonal antibody (M03), clone 5A5 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant PAFAH1B1. |
| Clone: | 5A5 |
| Isotype: | IgG2a Kappa |
| Gene id: | 5048 |
| Gene name: | PAFAH1B1 |
| Gene alias: | LIS1|LIS2|MDCR|MDS|PAFAH |
| Gene description: | platelet-activating factor acetylhydrolase, isoform Ib, alpha subunit 45kDa |
| Genbank accession: | NM_000430 |
| Immunogen: | PAFAH1B1 (NP_000421, 1 a.a. ~ 110 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | MVLSQRQRDELNRAIADYLRSNGYEEAYSVFKKEAELDVNEELDKKYAGLLEKKWTSVIRLQKKVMELESKLNEAKEEFTSGGPLGQKRDPKEWIPRPPEKYALSGHRSP |
| Protein accession: | NP_000421 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (37.84 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | Western Blot analysis of PAFAH1B1 expression in transfected 293T cell line by PAFAH1B1 monoclonal antibody (M03), clone 5A5. Lane 1: PAFAH1B1 transfected lysate(46.6 KDa). Lane 2: Non-transfected lysate. |
| Applications: | IF,S-ELISA,ELISA,WB-Re,WB-Tr |
| Shipping condition: | Dry Ice |