Cart 50 Product Products 48 674,19 € (empty)
No products
265,00 € DAP Shipping
48 939,19 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 50 items in your cart. There is 1 item in your cart.
Total products (tax excl.) 48 674,19 €
Total shipping (tax excl.) 265,00 €
Total (tax excl.) 48 939,19 €
Data sheet of PAEP monoclonal antibody (M01), clone 6G2
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | S-ELISA,ELISA,WB-Re,WB-Tr |
More info about PAEP monoclonal antibody (M01), clone 6G2
| Brand: | Abnova |
| Reference: | H00005047-M01 |
| Product name: | PAEP monoclonal antibody (M01), clone 6G2 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant PAEP. |
| Clone: | 6G2 |
| Isotype: | IgG1 Lambda |
| Gene id: | 5047 |
| Gene name: | PAEP |
| Gene alias: | GD|GdA|GdF|GdS|MGC138509|MGC142288|PAEG|PEP|PP14 |
| Gene description: | progestagen-associated endometrial protein |
| Genbank accession: | NM_002571 |
| Immunogen: | PAEP (NP_002562, 53 a.a. ~ 162 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | NLEIVLHRWENNSCVEKKVLGEKTENPKKFKINYTVANEATLLDTDYDNFLFLCLQDTTTPIQSMMCQYLARVLVEDDEIMQGFIRAFRPLPRHLWYLLDLKQMEEPCRF |
| Protein accession: | NP_002562 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (37.84 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | Western Blot analysis of PAEP expression in transfected 293T cell line by PAEP monoclonal antibody (M01), clone 6G2. Lane 1: PAEP transfected lysate(20.6 KDa). Lane 2: Non-transfected lysate. |
| Applications: | S-ELISA,ELISA,WB-Re,WB-Tr |
| Shipping condition: | Dry Ice |