PAEP monoclonal antibody (M01), clone 6G2 View larger

PAEP monoclonal antibody (M01), clone 6G2

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of PAEP monoclonal antibody (M01), clone 6G2

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsS-ELISA,ELISA,WB-Re,WB-Tr

More info about PAEP monoclonal antibody (M01), clone 6G2

Brand: Abnova
Reference: H00005047-M01
Product name: PAEP monoclonal antibody (M01), clone 6G2
Product description: Mouse monoclonal antibody raised against a partial recombinant PAEP.
Clone: 6G2
Isotype: IgG1 Lambda
Gene id: 5047
Gene name: PAEP
Gene alias: GD|GdA|GdF|GdS|MGC138509|MGC142288|PAEG|PEP|PP14
Gene description: progestagen-associated endometrial protein
Genbank accession: NM_002571
Immunogen: PAEP (NP_002562, 53 a.a. ~ 162 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: NLEIVLHRWENNSCVEKKVLGEKTENPKKFKINYTVANEATLLDTDYDNFLFLCLQDTTTPIQSMMCQYLARVLVEDDEIMQGFIRAFRPLPRHLWYLLDLKQMEEPCRF
Protein accession: NP_002562
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00005047-M01-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (37.84 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00005047-M01-13-15-1.jpg
Application image note: Western Blot analysis of PAEP expression in transfected 293T cell line by PAEP monoclonal antibody (M01), clone 6G2.

Lane 1: PAEP transfected lysate(20.6 KDa).
Lane 2: Non-transfected lysate.
Applications: S-ELISA,ELISA,WB-Re,WB-Tr
Shipping condition: Dry Ice

Reviews

Buy PAEP monoclonal antibody (M01), clone 6G2 now

Add to cart