Product successfully added to your shopping cart
Quantity
Total
There are 1 items in your cart. There is 1 item in your cart.
Total products (tax excl.) 395,00 €
Total shipping (tax excl.) To be determined
Total (tax excl.) 395,00 €
Data sheet of PAEP purified MaxPab rabbit polyclonal antibody (D01P)
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Rabbit |
| Applications | WB-Ti,WB-Tr |
More info about PAEP purified MaxPab rabbit polyclonal antibody (D01P)
| Brand: | Abnova |
| Reference: | H00005047-D01P |
| Product name: | PAEP purified MaxPab rabbit polyclonal antibody (D01P) |
| Product description: | Rabbit polyclonal antibody raised against a full-length human PAEP protein. |
| Gene id: | 5047 |
| Gene name: | PAEP |
| Gene alias: | GD|GdA|GdF|GdS|MGC138509|MGC142288|PAEG|PEP|PP14 |
| Gene description: | progestagen-associated endometrial protein |
| Genbank accession: | NM_002571.2 |
| Immunogen: | PAEP (NP_002562.2, 1 a.a. ~ 180 a.a) full-length human protein. |
| Immunogen sequence/protein sequence: | MLCLLLTLGVALVCGVPAMDIPQTKQDLELPKLAGTWHSMAMATNNISLMATLKAPLRVHITSLLPTPEDNLEIVLHRWENNSCVEKKVLGEKTENPKKFKINYTVANEATLLDTDYDNFLFLCLQDTTTPIQSMMCQYLARVLVEDDEIMQGFIRAFRPLPRHLWYLLDLKQMEEPCRF |
| Protein accession: | NP_002562.2 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody reactive against mammalian transfected lysate. |
| Product type: | Primary antibodies |
| Host species: | Rabbit |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | Western Blot analysis of PAEP expression in transfected 293T cell line (H00005047-T02) by PAEP MaxPab polyclonal antibody. Lane 1: PAEP transfected lysate(20.60 KDa). Lane 2: Non-transfected lysate. |
| Applications: | WB-Ti,WB-Tr |
| Shipping condition: | Dry Ice |