Brand: | Abnova |
Reference: | H00005046-M01 |
Product name: | PCSK6 monoclonal antibody (M01), clone 2D6 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant PCSK6. |
Clone: | 2D6 |
Isotype: | IgG2a Kappa |
Gene id: | 5046 |
Gene name: | PCSK6 |
Gene alias: | PACE4|SPC4 |
Gene description: | proprotein convertase subtilisin/kexin type 6 |
Genbank accession: | NM_002570 |
Immunogen: | PCSK6 (NP_002561, 860 a.a. ~ 969 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | REECIHCAKNFHFHDWKCVPACGEGFYPEEMPGLPHKVCRRCDENCLSCAGSSRNCSRCKTGFTQLGTSCITNHTCSNADETFCEMVKSNRLCERKLFIQFCCRTCLLAG |
Protein accession: | NP_002561 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (37.84 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: |  |
Application image note: | Detection limit for recombinant GST tagged PCSK6 is approximately 0.1ng/ml as a capture antibody. |
Applications: | S-ELISA,ELISA,WB-Re |
Shipping condition: | Dry Ice |