PCSK6 monoclonal antibody (M01), clone 2D6 View larger

PCSK6 monoclonal antibody (M01), clone 2D6

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of PCSK6 monoclonal antibody (M01), clone 2D6

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsS-ELISA,ELISA,WB-Re

More info about PCSK6 monoclonal antibody (M01), clone 2D6

Brand: Abnova
Reference: H00005046-M01
Product name: PCSK6 monoclonal antibody (M01), clone 2D6
Product description: Mouse monoclonal antibody raised against a partial recombinant PCSK6.
Clone: 2D6
Isotype: IgG2a Kappa
Gene id: 5046
Gene name: PCSK6
Gene alias: PACE4|SPC4
Gene description: proprotein convertase subtilisin/kexin type 6
Genbank accession: NM_002570
Immunogen: PCSK6 (NP_002561, 860 a.a. ~ 969 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: REECIHCAKNFHFHDWKCVPACGEGFYPEEMPGLPHKVCRRCDENCLSCAGSSRNCSRCKTGFTQLGTSCITNHTCSNADETFCEMVKSNRLCERKLFIQFCCRTCLLAG
Protein accession: NP_002561
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00005046-M01-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (37.84 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00005046-M01-9-21-1.jpg
Application image note: Detection limit for recombinant GST tagged PCSK6 is approximately 0.1ng/ml as a capture antibody.
Applications: S-ELISA,ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy PCSK6 monoclonal antibody (M01), clone 2D6 now

Add to cart