Brand: | Abnova |
Reference: | H00005046-A01 |
Product name: | PCSK6 polyclonal antibody (A01) |
Product description: | Mouse polyclonal antibody raised against a partial recombinant PCSK6. |
Gene id: | 5046 |
Gene name: | PCSK6 |
Gene alias: | PACE4|SPC4 |
Gene description: | proprotein convertase subtilisin/kexin type 6 |
Genbank accession: | NM_002570 |
Immunogen: | PCSK6 (NP_002561, 860 a.a. ~ 969 a.a) partial recombinant protein with GST tag. |
Immunogen sequence/protein sequence: | REECIHCAKNFHFHDWKCVPACGEGFYPEEMPGLPHKVCRRCDENCLSCAGSSRNCSRCKTGFTQLGTSCITNHTCSNADETFCEMVKSNRLCERKLFIQFCCRTCLLAG |
Protein accession: | NP_002561 |
Storage buffer: | 50 % glycerol |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (38.21 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human,Mouse,Rat |
Application image: |  |
Application image note: | PCSK6 polyclonal antibody (A01), Lot # FIS28060515QCS1 Western Blot analysis of PCSK6 expression in Hela S3 NE ( Cat # L013V3 ). |
Applications: | WB-Ce,ELISA,WB-Re |
Shipping condition: | Dry Ice |
Publications: | EXTRACELLULAR AND MEMBRANE-ASSOCIATED PROSTATE CANCER MARKERSKlee, George G. ;Vasmatzis, George;Kosari, Farhad;Klee, Eric W. FreshPatents.com |