Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of P2RY1 monoclonal antibody (M01), clone 4C2
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | IF,S-ELISA,ELISA,WB-Re |
More info about P2RY1 monoclonal antibody (M01), clone 4C2
| Brand: | Abnova |
| Reference: | H00005028-M01 |
| Product name: | P2RY1 monoclonal antibody (M01), clone 4C2 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant P2RY1. |
| Clone: | 4C2 |
| Isotype: | IgG2a Kappa |
| Gene id: | 5028 |
| Gene name: | P2RY1 |
| Gene alias: | P2Y1 |
| Gene description: | purinergic receptor P2Y, G-protein coupled, 1 |
| Genbank accession: | NM_002563 |
| Immunogen: | P2RY1 (NP_002554, 1 a.a. ~ 52 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | MTEVLWPAVPNGTDAAFLAGPGSSWGNSTVASTAAVSSSFKCALTKTGFQFY |
| Protein accession: | NP_002554 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (31.46 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | Detection limit for recombinant GST tagged P2RY1 is approximately 1ng/ml as a capture antibody. |
| Applications: | IF,S-ELISA,ELISA,WB-Re |
| Shipping condition: | Dry Ice |
| Publications: | Altered Distribution of Small-Conductance Calcium-Activated Potassium Channel Sk3 In Hirschsprung’s Disease.Coyle D, O’Donnell AM, Puri P. Journal of Pediatric Surgery doi:10.1016/j.jpedsurg.2015.01.013 |