Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of P2RX5 monoclonal antibody (M01), clone 1C5
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | S-ELISA,ELISA,WB-Re,WB-Tr,RNAi-Ab |
More info about P2RX5 monoclonal antibody (M01), clone 1C5
| Brand: | Abnova |
| Reference: | H00005026-M01 |
| Product name: | P2RX5 monoclonal antibody (M01), clone 1C5 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant P2RX5. |
| Clone: | 1C5 |
| Isotype: | IgG1 Kappa |
| Gene id: | 5026 |
| Gene name: | P2RX5 |
| Gene alias: | MGC47755|P2X5|P2X5R |
| Gene description: | purinergic receptor P2X, ligand-gated ion channel, 5 |
| Genbank accession: | NM_002561 |
| Immunogen: | P2RX5 (NP_002552, 126 a.a. ~ 224 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | DGACSKDSDCHAGEAVTAGNGVKTGRCLRRENLARGTCEIFAWCPLETSSRPEEPFLKEAEDFTIFIKNHIRFPKFNFSKSNVMDVKDRSFLKSCHFGP |
| Protein accession: | NP_002552 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (36.63 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | Western Blot analysis of P2RX5 expression in transfected 293T cell line by P2RX5 monoclonal antibody (M01), clone 1C5. Lane 1: P2RX5 transfected lysate(46.42 KDa). Lane 2: Non-transfected lysate. |
| Applications: | S-ELISA,ELISA,WB-Re,WB-Tr,RNAi-Ab |
| Shipping condition: | Dry Ice |
| Publications: | A Truncation Variant of the Cation Channel P2RX5 Is Upregulated during T Cell Activation.Abramowski P, Ogrodowczyk C, Martin R, Pongs O PLoS One. 2014 Sep 2;9(9):e104692. doi: 10.1371/journal.pone.0104692. eCollection 2014. |