Brand: | Abnova |
Reference: | H00005017-M01 |
Product name: | OVOL1 monoclonal antibody (M01), clone 1B3 |
Product description: | Mouse monoclonal antibody raised against a full-length recombinant OVOL1. |
Clone: | 1B3 |
Isotype: | IgG1 Kappa |
Gene id: | 5017 |
Gene name: | OVOL1 |
Gene alias: | HOVO1 |
Gene description: | ovo-like 1(Drosophila) |
Genbank accession: | BC059408 |
Immunogen: | OVOL1 (AAH59408, 1 a.a. ~ 267 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | MPRAFLVKKPCVSTCKRNWSELPDEGRGEIYVPVSLGFCPPQPYREPEPSVAEPPSCPLALNMSLRDSSYSMAPGPCVVAQLPSEDMGHLTDPQSRDHGFLRAKMKVTLGDSPSGDLFTCRVCQRAFTYQRMLNRHMKCHNDVKRHLCTYCGKGFNDTFDLKRHVRTHTGVRPYKCSLCDKAFTQRCSLESHLKKIHGVQQKYAYKERRAKLYVCEECGCTSESQEGHVLHLKEHHPDSPLLRKTSKKVAVALQNTVTSLLQGSPHL |
Protein accession: | AAH59408 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: |  |
Application image note: | Detection limit for recombinant GST tagged OVOL1 is 3 ng/ml as a capture antibody. |
Applications: | S-ELISA,ELISA |
Shipping condition: | Dry Ice |