OTX1 monoclonal antibody (M07), clone 3A5 View larger

OTX1 monoclonal antibody (M07), clone 3A5

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of OTX1 monoclonal antibody (M07), clone 3A5

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsIF,S-ELISA,ELISA,WB-Re

More info about OTX1 monoclonal antibody (M07), clone 3A5

Brand: Abnova
Reference: H00005013-M07
Product name: OTX1 monoclonal antibody (M07), clone 3A5
Product description: Mouse monoclonal antibody raised against a partial recombinant OTX1.
Clone: 3A5
Isotype: IgG2a Kappa
Gene id: 5013
Gene name: OTX1
Gene alias: FLJ38361|MGC15736
Gene description: orthodenticle homeobox 1
Genbank accession: NM_014562
Immunogen: OTX1 (NP_055377, 10 a.a. ~ 116 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: YGMNGLGLAGPAMDLLHPSVGYPATPRKQRRERTTFTRSQLDVLEALFAKTRYPDIFMREEVALKINLPESRVQVWFKNRRAKCRQQQQSGSGTKSRPAKKKSSPVR
Protein accession: NP_055377
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00005013-M07-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (37.51 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00005013-M07-9-22-1.jpg
Application image note: Detection limit for recombinant GST tagged OTX1 is approximately 0.03ng/ml as a capture antibody.
Applications: IF,S-ELISA,ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy OTX1 monoclonal antibody (M07), clone 3A5 now

Add to cart