Brand: | Abnova |
Reference: | H00005007-M01 |
Product name: | OSBP monoclonal antibody (M01), clone 5A3 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant OSBP. |
Clone: | 5A3 |
Isotype: | IgG2a Kappa |
Gene id: | 5007 |
Gene name: | OSBP |
Gene alias: | OSBP1 |
Gene description: | oxysterol binding protein |
Genbank accession: | NM_002556 |
Immunogen: | OSBP (NP_002547.1, 324 a.a. ~ 407 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | GATVLPANTPGNVGSGKDQCCSGKGDMSDEDDENEFFDAPEIITMPENLGHKRTGSNISGASSDISLDEQYKHQLEETKKEKRT |
Protein accession: | NP_002547.1 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (34.98 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: |  |
Application image note: | OSBP monoclonal antibody (M01), clone 5A3. Western Blot analysis of OSBP expression in Jurkat. |
Applications: | WB-Ce,S-ELISA,ELISA,WB-Re |
Shipping condition: | Dry Ice |