Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of OPRK1 polyclonal antibody (A01)
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human,Rat |
| Host species | Mouse |
| Applications | WB-Ti,ELISA,WB-Re |
More info about OPRK1 polyclonal antibody (A01)
| Brand: | Abnova |
| Reference: | H00004986-A01 |
| Product name: | OPRK1 polyclonal antibody (A01) |
| Product description: | Mouse polyclonal antibody raised against a partial recombinant OPRK1. |
| Gene id: | 4986 |
| Gene name: | OPRK1 |
| Gene alias: | KOR|OPRK |
| Gene description: | opioid receptor, kappa 1 |
| Genbank accession: | NM_000912 |
| Immunogen: | OPRK1 (NP_000903, 1 a.a. ~ 58 a.a) partial recombinant protein with GST tag. |
| Immunogen sequence/protein sequence: | MDSPIQIFRGEPGPTCAPSACLPPNSSAWFPGWAEPDSNGSAGSEDAQLEPAHISPAI |
| Protein accession: | NP_000903 |
| Storage buffer: | 50 % glycerol |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (32.49 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human,Rat |
| Application image: |  |
| Application image note: | OPRK1 polyclonal antibody (A01), Lot # 050928JC01. Western Blot analysis of OPRK1 expression in human ovarian cancer. |
| Applications: | WB-Ti,ELISA,WB-Re |
| Shipping condition: | Dry Ice |
| Publications: | Electroacupuncture relieves labour pain and influences the spinal dynorphin/κ-opioid receptor system in rats.Jiang QY, Wang MY, Li L, Mo HX, Song JL, Tang QL, Feng XT. Acupunct Med. 2016 Jun;34(3):223-8. Epub 2016 Jan 5. |