OPHN1 monoclonal antibody (M03), clone 2B9 View larger

OPHN1 monoclonal antibody (M03), clone 2B9

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of OPHN1 monoclonal antibody (M03), clone 2B9

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsS-ELISA,ELISA,WB-Re

More info about OPHN1 monoclonal antibody (M03), clone 2B9

Brand: Abnova
Reference: H00004983-M03
Product name: OPHN1 monoclonal antibody (M03), clone 2B9
Product description: Mouse monoclonal antibody raised against a partial recombinant OPHN1.
Clone: 2B9
Isotype: IgG2a Kappa
Gene id: 4983
Gene name: OPHN1
Gene alias: MRX60|OPN1
Gene description: oligophrenin 1
Genbank accession: NM_002547
Immunogen: OPHN1 (NP_002538, 641 a.a. ~ 734 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: QRSGETDPGRKSPSRPILDGKLEPCPEVDVGKLVSRLQDGGTKITPKATNGPMPGSGPTKTPSFHIKRPAPRPLAHHKEGDADSFSKVRPPGEK
Protein accession: NP_002538
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00004983-M03-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (36.08 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00004983-M03-9-20-1.jpg
Application image note: Detection limit for recombinant GST tagged OPHN1 is approximately 0.3ng/ml as a capture antibody.
Applications: S-ELISA,ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy OPHN1 monoclonal antibody (M03), clone 2B9 now

Add to cart