No products
Prices are tax excluded
Brand | Abnova |
Product type | Primary antibodies |
Reactivity | Human,Rat |
Host species | Mouse |
Applications | WB-Ce,WB-Ti,S-ELISA,ELISA,WB-Re,WB-Tr |
Brand: | Abnova |
Reference: | H00004976-M06 |
Product name: | OPA1 monoclonal antibody (M06), clone 8A32 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant OPA1. |
Clone: | 8A32 |
Isotype: | IgG2a Kappa |
Gene id: | 4976 |
Gene name: | OPA1 |
Gene alias: | FLJ12460|KIAA0567|MGM1|NPG|NTG|largeG |
Gene description: | optic atrophy 1 (autosomal dominant) |
Genbank accession: | NM_015560 |
Immunogen: | OPA1 (NP_056375, 851 a.a. ~ 960 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | NHCNLCRRGFYYYQRHFVDSELECNDVVLFWRIQRMLAITANTLRQQLTNTEVRRLEKNVKEVLEDFAEDGEKKIKLLTGKRVQLAEDLKKVREIQEKLDAFIEALHQEK |
Protein accession: | NP_056375 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: | ![]() |
Quality control testing picture note: | Western Blot detection against Immunogen (37.84 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human,Rat |
Application image: | ![]() |
Application image note: | OPA1 monoclonal antibody (M06), clone 8A32. Western Blot analysis of OPA1 expression in Daoy. |
Applications: | WB-Ce,WB-Ti,S-ELISA,ELISA,WB-Re,WB-Tr |
Shipping condition: | Dry Ice |