No products
Prices are tax excluded
Brand | Abnova |
Product type | Primary antibodies |
Reactivity | Human |
Host species | Mouse |
Applications | S-ELISA,ELISA |
Brand: | Abnova |
Reference: | H00004974-M06 |
Product name: | OMG monoclonal antibody (M06), clone 1A8 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant OMG. |
Clone: | 1A8 |
Isotype: | IgG2a Kappa |
Gene id: | 4974 |
Gene name: | OMG |
Gene alias: | OMGP |
Gene description: | oligodendrocyte myelin glycoprotein |
Genbank accession: | NM_002544 |
Immunogen: | OMG (NP_002535, 26 a.a. ~ 134 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | CPLQCICTERHRHVDCSGRNLSTLPSGLQENIIHLNLSYNHFTDLHNQLTQYTNLRTLDISNNRLESLPAHLPRSLWNMSAANNNIKLLDKSDTAYQWNLKYLDVSKNM |
Protein accession: | NP_002535 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: | ![]() |
Application image note: | Detection limit for recombinant GST tagged OMG is approximately 10ng/ml as a capture antibody. |
Applications: | S-ELISA,ELISA |
Shipping condition: | Dry Ice |
Publications: | Oligodendrocyte Myelin Glycoprotein Does Not Influence Node of Ranvier Structure or Assembly.Chang KJ, Susuki K, Dours-Zimmermann MT, Zimmermann DR, Rasband MN. J Neurosci. 2010 Oct 27;30(43):14476-81. |