Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of OMG monoclonal antibody (M06), clone 1A8
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | S-ELISA,ELISA |
More info about OMG monoclonal antibody (M06), clone 1A8
| Brand: | Abnova |
| Reference: | H00004974-M06 |
| Product name: | OMG monoclonal antibody (M06), clone 1A8 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant OMG. |
| Clone: | 1A8 |
| Isotype: | IgG2a Kappa |
| Gene id: | 4974 |
| Gene name: | OMG |
| Gene alias: | OMGP |
| Gene description: | oligodendrocyte myelin glycoprotein |
| Genbank accession: | NM_002544 |
| Immunogen: | OMG (NP_002535, 26 a.a. ~ 134 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | CPLQCICTERHRHVDCSGRNLSTLPSGLQENIIHLNLSYNHFTDLHNQLTQYTNLRTLDISNNRLESLPAHLPRSLWNMSAANNNIKLLDKSDTAYQWNLKYLDVSKNM |
| Protein accession: | NP_002535 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | Detection limit for recombinant GST tagged OMG is approximately 10ng/ml as a capture antibody. |
| Applications: | S-ELISA,ELISA |
| Shipping condition: | Dry Ice |
| Publications: | Oligodendrocyte Myelin Glycoprotein Does Not Influence Node of Ranvier Structure or Assembly.Chang KJ, Susuki K, Dours-Zimmermann MT, Zimmermann DR, Rasband MN. J Neurosci. 2010 Oct 27;30(43):14476-81. |