OLR1 MaxPab rabbit polyclonal antibody (D01) View larger

OLR1 MaxPab rabbit polyclonal antibody (D01)

New product

384,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of OLR1 MaxPab rabbit polyclonal antibody (D01)

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesRabbit
ApplicationsWB-Tr,IP

More info about OLR1 MaxPab rabbit polyclonal antibody (D01)

Brand: Abnova
Reference: H00004973-D01
Product name: OLR1 MaxPab rabbit polyclonal antibody (D01)
Product description: Rabbit polyclonal antibody raised against a full-length human OLR1 protein.
Gene id: 4973
Gene name: OLR1
Gene alias: CLEC8A|LOX1|SCARE1
Gene description: oxidized low density lipoprotein (lectin-like) receptor 1
Genbank accession: NM_002543.2
Immunogen: OLR1 (NP_002534.1, 1 a.a. ~ 273 a.a) full-length human protein.
Immunogen sequence/protein sequence: MTFDDLKIQTVKDQPDEKSNGKKAKGLQFLYSPWWCLAAATLGVLCLGLVVTIMVLGMQLSQVSDLLTQEQANLTHQKKKLEGQISARQQAEEASQESENELKEMIETLARKLNEKSKEQMELHHQNLNLQETLKRVANCSAPCPQDWIWHGENCYLFSSGSFNWEKSQEKCLSLDAKLLKINSTADLDFIQQAISYSSFPFWMGLSRRNPSYPWLWEDGSPLMPHLFRVRGAVSQTYPSGTCAYIQRGAVYAENCILAAFSICQKKANLRAQ
Protein accession: NP_002534.1
Storage buffer: No additive
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody reactive against mammalian transfected lysate.
Product type: Primary antibodies
Host species: Rabbit
Antigen species / target species: Human
Reactivity: Human
Application image: H00004973-D01-31-15-1.jpg
Application image note: Immunoprecipitation of OLR1 transfected lysate using anti-OLR1 MaxPab rabbit polyclonal antibody and Protein A Magnetic Bead (U0007), and immunoblotted with OLR1 MaxPab mouse polyclonal antibody (B01) (H00004973-B01).
Applications: WB-Tr,IP
Shipping condition: Dry Ice

Reviews

Buy OLR1 MaxPab rabbit polyclonal antibody (D01) now

Add to cart