Brand: | Abnova |
Reference: | H00004958-M01 |
Product name: | OMD monoclonal antibody (M01), clone 1E10 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant OMD. |
Clone: | 1E10 |
Isotype: | IgG3 Kappa |
Gene id: | 4958 |
Gene name: | OMD |
Gene alias: | OSAD|SLRR2C |
Gene description: | osteomodulin |
Genbank accession: | NM_005014 |
Immunogen: | OMD (NP_005005, 274 a.a. ~ 383 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | YNIFNLPNIVELSVGHNKLKQAFYIPRNLEHLYLQNNEIEKMNLTVMCPSIDPLHYHHLTYIRVDQNKLKEPISSYIFFCFPHIHTIYYGEQRSTNGQTIQLKTQVFRRF |
Protein accession: | NP_005005 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: | http://www.abnova.com/application_image/ |
Application image note: | Detection limit for recombinant GST tagged OMD is approximately 10ng/ml as a capture antibody. |
Applications: | S-ELISA,ELISA |
Shipping condition: | Dry Ice |