No products
Prices are tax excluded
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | IF,S-ELISA,ELISA,WB-Re |
| Brand: | Abnova |
| Reference: | H00004957-M01 |
| Product name: | ODF2 monoclonal antibody (M01), clone 1A1 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant ODF2. |
| Clone: | 1A1 |
| Isotype: | IgG2a Kappa |
| Gene id: | 4957 |
| Gene name: | ODF2 |
| Gene alias: | FLJ44866|MGC111096|MGC9034|ODF2/1|ODF2/2|ODF84 |
| Gene description: | outer dense fiber of sperm tails 2 |
| Genbank accession: | NM_002540 |
| Immunogen: | ODF2 (NP_002531.3, 706 a.a. ~ 804 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | KEHALSKERAAQNKILDLETQLSRTKTELSQLRRSRDDADRRYQSRLQDLKDRLEQSESTNRSMQNYVQFLKSSYANVFGDGPYSTFLTSSPIRSRSPP |
| Protein accession: | NP_002531.3 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: | ![]() |
| Quality control testing picture note: | Western Blot detection against Immunogen (36.63 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: | http://www.abnova.com/application_image/ |
| Application image note: | Detection limit for recombinant GST tagged ODF2 is approximately 30ng/ml as a capture antibody. |
| Applications: | IF,S-ELISA,ELISA,WB-Re |
| Shipping condition: | Dry Ice |
| Publications: | Type Iγ phosphatidylinositol phosphate kinase targets to the centrosome and restrains centriole duplication.Xu Q, Zhang Y, Xiong X, Huang Y, Salisbury JL, Hu J, Ling K J Cell Sci. 2014 Jan 16. |