Brand: | Abnova |
Reference: | H00004952-M02 |
Product name: | OCRL monoclonal antibody (M02), clone 4A6 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant OCRL. |
Clone: | 4A6 |
Isotype: | IgG2a Kappa |
Gene id: | 4952 |
Gene name: | OCRL |
Gene alias: | INPP5F|LOCR|NPHL2|OCRL1 |
Gene description: | oculocerebrorenal syndrome of Lowe |
Genbank accession: | NM_000276 |
Immunogen: | OCRL (NP_000267, 146 a.a. ~ 239 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | SGLLGFEDNFSSMNLDKKINSQNQPTGIHREPPPPPFSVNKMLPREKEASNKEQPKVTNTMRKLFVPNTQSGQREGLIKHILAKREKEYVNIQT |
Protein accession: | NP_000267 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (36.08 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: |  |
Application image note: | Immunoperoxidase of monoclonal antibody to OCRL on formalin-fixed paraffin-embedded human kidney. [antibody concentration 3 ug/ml] |
Applications: | WB-Ce,IHC-P,S-ELISA,ELISA,WB-Re,WB-Tr,RNAi-Ab |
Shipping condition: | Dry Ice |