No products
Prices are tax excluded
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | WB-Ce,IF,S-ELISA,ELISA,WB-Re,IP |
| Brand: | Abnova |
| Reference: | H00004950-M01 |
| Product name: | OCLN monoclonal antibody (M01), clone 1G7 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant OCLN. |
| Clone: | 1G7 |
| Isotype: | IgG1 Kappa |
| Gene id: | 4950 |
| Gene name: | OCLN |
| Gene alias: | - |
| Gene description: | occludin |
| Genbank accession: | NM_002538 |
| Immunogen: | OCLN (NP_002529, 423 a.a. ~ 522 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | ITSDQQRQLYKRNFDTGLQEYKSLQSELDEINKELSRLDKELDDYREESEEYMAAADEYNRLKQVKGSADYKSKKNHCKQLKSKLSHIKKMVGDYDRQKT |
| Protein accession: | NP_002529 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: | ![]() |
| Quality control testing picture note: | Western Blot detection against Immunogen (36.74 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: | ![]() |
| Application image note: | Immunofluorescence of monoclonal antibody to OCLN on HeLa cell. [antibody concentration 10 ug/ml] |
| Applications: | WB-Ce,IF,S-ELISA,ELISA,WB-Re,IP |
| Shipping condition: | Dry Ice |
| Publications: | Mouse homologues of hepatitis C virus human entry factors inhibit the entry of HCV pseudoparticles (HCVpp) into human hepatoma cells. Islam MJ, Amin MB, Uddin MKM, Hikosaka K, Noritake H, Wu Y, Aoto K, Miura N. Bioresearch Communications. 2016 Jan; 2(1):128-133. |