Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of OAS1 monoclonal antibody (M01), clone 2D4
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Clonality | Monoclonal |
| Host species | Mouse |
| Applications | IHC-P,IF,S-ELISA,ELISA,IP |
More info about OAS1 monoclonal antibody (M01), clone 2D4
| Product description: | Mouse monoclonal antibody raised against a partial recombinant OAS1. |
| Clone: | 2D4 |
| Isotype: | IgG2a Kappa |
| Gene id: | 4938 |
| Gene name: | OAS1 |
| Gene alias: | IFI-4|OIAS|OIASI |
| Gene description: | 2',5'-oligoadenylate synthetase 1, 40/46kDa |
| Genbank accession: | BC000562 |
| Immunogen: | OAS1 (AAH00562, 1 a.a. ~ 100 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | SVSRRDKSKQVWEAVLLPLSLLSMMDLRNTPAKSLDKFIEDYLLPDTCFRMQINHAIDIICGFLKERCFRGSSYPVCVSKVVKGGSSGKGTTLRGRSDAD |
| Protein accession: | AAH00562 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Size: | 100 ug |
| Shipping condition: | Dry Ice |