NVL monoclonal antibody (M03), clone 3D10 View larger

NVL monoclonal antibody (M03), clone 3D10

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of NVL monoclonal antibody (M03), clone 3D10

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsS-ELISA,ELISA,WB-Re,WB-Tr

More info about NVL monoclonal antibody (M03), clone 3D10

Brand: Abnova
Reference: H00004931-M03
Product name: NVL monoclonal antibody (M03), clone 3D10
Product description: Mouse monoclonal antibody raised against a partial recombinant NVL.
Clone: 3D10
Isotype: IgG1 Kappa
Gene id: 4931
Gene name: NVL
Gene alias: -
Gene description: nuclear VCP-like
Genbank accession: NM_002533
Immunogen: NVL (NP_002524, 757 a.a. ~ 856 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: ILKTITKNGTKPPLDADVNLEAIAGDLRCDCYTGADLSALVREASICALRQEMARQKSGNEKGELKVSHKHFEEAFKKVRSSISKKDQIMYERLQESLSR
Protein accession: NP_002524
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00004931-M03-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (36.74 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00004931-M03-9-21-1.jpg
Application image note: Detection limit for recombinant GST tagged NVL is approximately 0.1ng/ml as a capture antibody.
Applications: S-ELISA,ELISA,WB-Re,WB-Tr
Shipping condition: Dry Ice

Reviews

Buy NVL monoclonal antibody (M03), clone 3D10 now

Add to cart