Brand: | Abnova |
Reference: | H00004929-M21 |
Product name: | NR4A2 monoclonal antibody (M21), clone 2C12 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant NR4A2. |
Clone: | 2C12 |
Isotype: | IgG2b Kappa |
Gene id: | 4929 |
Gene name: | NR4A2 |
Gene alias: | HZF-3|NOT|NURR1|RNR1|TINUR |
Gene description: | nuclear receptor subfamily 4, group A, member 2 |
Genbank accession: | NM_006186 |
Immunogen: | NR4A2 (NP_006177, 147 a.a. ~ 250 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | GSLHNFHQNYVATTHMIEQRKTPVSRLSLFSFKQSPPGTPVSSCQMRFDGPLHVPMNPEPAGSHHVVDGQTFAVPNPIRKPASMGFPGLQIGHASQLLDTQVPS* |
Protein accession: | NP_006177 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (37.55 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Applications: | ELISA,WB-Re |
Shipping condition: | Dry Ice |