| Brand: | Abnova |
| Reference: | H00004929-M19 |
| Product name: | NR4A2 monoclonal antibody (M19), clone 1D9 |
| Product description: | Mouse monoclonal antibody raised against a full length recombinant NR4A2. |
| Clone: | 1D9 |
| Isotype: | IgG2b Kappa |
| Gene id: | 4929 |
| Gene name: | NR4A2 |
| Gene alias: | HZF-3|NOT|NURR1|RNR1|TINUR |
| Gene description: | nuclear receptor subfamily 4, group A, member 2 |
| Genbank accession: | NM_006186 |
| Immunogen: | NR4A2 (NP_006177, 147 a.a. ~ 250 a.a) full length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | GSLHNFHQNYVATTHMIEQRKTPVSRLSLFSFKQSPPGTPVSSCQMRFDGPLHVPMNPEPAGSHHVVDGQTFAVPNPIRKPASMGFPGLQIGHASQLLDTQVPS* |
| Protein accession: | NP_006177 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (37.55 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Applications: | ELISA,WB-Re |
| Shipping condition: | Dry Ice |