NR4A2 monoclonal antibody (M17), clone 3F2 View larger

NR4A2 monoclonal antibody (M17), clone 3F2

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of NR4A2 monoclonal antibody (M17), clone 3F2

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsELISA,WB-Re

More info about NR4A2 monoclonal antibody (M17), clone 3F2

Brand: Abnova
Reference: H00004929-M17
Product name: NR4A2 monoclonal antibody (M17), clone 3F2
Product description: Mouse monoclonal antibody raised against a full length recombinant NR4A2.
Clone: 3F2
Isotype: IgG2b Kappa
Gene id: 4929
Gene name: NR4A2
Gene alias: HZF-3|NOT|NURR1|RNR1|TINUR
Gene description: nuclear receptor subfamily 4, group A, member 2
Genbank accession: NM_006186
Immunogen: NR4A2 (NP_006177, 147 a.a. ~ 250 a.a) full length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: GSLHNFHQNYVATTHMIEQRKTPVSRLSLFSFKQSPPGTPVSSCQMRFDGPLHVPMNPEPAGSHHVVDGQTFAVPNPIRKPASMGFPGLQIGHASQLLDTQVPS*
Protein accession: NP_006177
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00004929-M17-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (37.55 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Applications: ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy NR4A2 monoclonal antibody (M17), clone 3F2 now

Add to cart