NR4A2 monoclonal antibody (M08), clone 2G5 View larger

NR4A2 monoclonal antibody (M08), clone 2G5

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of NR4A2 monoclonal antibody (M08), clone 2G5

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsWB-Ce,WB-Ti,IF,S-ELISA,ELISA,WB-Re,WB-Tr

More info about NR4A2 monoclonal antibody (M08), clone 2G5

Brand: Abnova
Reference: H00004929-M08
Product name: NR4A2 monoclonal antibody (M08), clone 2G5
Product description: Mouse monoclonal antibody raised against a partial recombinant NR4A2.
Clone: 2G5
Isotype: IgG2a Kappa
Gene id: 4929
Gene name: NR4A2
Gene alias: HZF-3|NOT|NURR1|RNR1|TINUR
Gene description: nuclear receptor subfamily 4, group A, member 2
Genbank accession: BC066890
Immunogen: NR4A2 (AAH66890, 71 a.a. ~ 170 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: GFQVQHSPMWDDPGSLHNFHQNYVATTHMIEQRKTPVSRLSLFSFKQSPPGTPVSSCQMRFDGPLHVPMNPEPAGSHHVVDGQTFAVPNPIRKPASMGFP
Protein accession: AAH66890
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00004929-M08-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (36.63 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00004929-M08-2-A3-1.jpg
Application image note: NR4A2 monoclonal antibody (M08), clone 2G5. Western Blot analysis of NR4A2 expression in human stomach.
Applications: WB-Ce,WB-Ti,IF,S-ELISA,ELISA,WB-Re,WB-Tr
Shipping condition: Dry Ice

Reviews

Buy NR4A2 monoclonal antibody (M08), clone 2G5 now

Add to cart