Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of NR4A2 monoclonal antibody (M07A), clone 4A6
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | ELISA,WB-Re,WB-Tr |
More info about NR4A2 monoclonal antibody (M07A), clone 4A6
| Brand: | Abnova |
| Reference: | H00004929-M07A |
| Product name: | NR4A2 monoclonal antibody (M07A), clone 4A6 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant NR4A2. |
| Clone: | 4A6 |
| Isotype: | IgG2a Kappa |
| Gene id: | 4929 |
| Gene name: | NR4A2 |
| Gene alias: | HZF-3|NOT|NURR1|RNR1|TINUR |
| Gene description: | nuclear receptor subfamily 4, group A, member 2 |
| Genbank accession: | BC066890 |
| Immunogen: | NR4A2 (AAH66890, 71 a.a. ~ 170 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | GFQVQHSPMWDDPGSLHNFHQNYVATTHMIEQRKTPVSRLSLFSFKQSPPGTPVSSCQMRFDGPLHVPMNPEPAGSHHVVDGQTFAVPNPIRKPASMGFP |
| Protein accession: | AAH66890 |
| Storage buffer: | In ascites fluid |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (36.63 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | Western Blot analysis of NR4A2 expression in transfected 293T cell line by NR4A2 monoclonal antibody (M07A), clone 4A6. Lane 1: NR4A2 transfected lysate (Predicted MW: 66.6 KDa). Lane 2: Non-transfected lysate. |
| Applications: | ELISA,WB-Re,WB-Tr |
| Shipping condition: | Dry Ice |