No products
Prices are tax excluded
Brand | Abnova |
Product type | Primary antibodies |
Reactivity | Human |
Host species | Mouse |
Applications | WB-Ce,WB-Ti,IF,S-ELISA,ELISA,WB-Re |
Brand: | Abnova |
Reference: | H00004929-M02 |
Product name: | NR4A2 monoclonal antibody (M02), clone 1G6 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant NR4A2. |
Clone: | 1G6 |
Isotype: | IgG2a Kappa |
Gene id: | 4929 |
Gene name: | NR4A2 |
Gene alias: | HZF-3|NOT|NURR1|RNR1|TINUR |
Gene description: | nuclear receptor subfamily 4, group A, member 2 |
Genbank accession: | BC066890 |
Immunogen: | NR4A2 (AAH66890, 71 a.a. ~ 170 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | GFQVQHSPMWDDPGSLHNFHQNYVATTHMIEQRKTPVSRLSLFSFKQSPPGTPVSSCQMRFDGPLHVPMNPEPAGSHHVVDGQTFAVPNPIRKPASMGFP |
Protein accession: | AAH66890 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: | ![]() |
Quality control testing picture note: | Western Blot detection against Immunogen (36.63 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: | ![]() |
Application image note: | NR4A2 monoclonal antibody (M02), clone 1G6. Western Blot analysis of NR4A2 expression in human stomach. |
Applications: | WB-Ce,WB-Ti,IF,S-ELISA,ELISA,WB-Re |
Shipping condition: | Dry Ice |