No products
Prices are tax excluded
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | ELISA |
| Brand: | Abnova |
| Reference: | H00004928-M01 |
| Product name: | NUP98 monoclonal antibody (M01), clone 4G2 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant NUP98. |
| Clone: | 4G2 |
| Isotype: | IgG2a Kappa |
| Gene id: | 4928 |
| Gene name: | NUP98 |
| Gene alias: | ADIR2|NUP196|NUP96 |
| Gene description: | nucleoporin 98kDa |
| Genbank accession: | BC012906.1 |
| Immunogen: | NUP98 (AAH12906.1, 1 a.a. ~ 110 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | MKLYQTPLELKLKHSTVHVDELCPLIVPNLGVAVIHDYADWVKEASGDLPEAQIVKHWSLTWTLCEALWGHLKELDSQLNEPREYIQILERRRAFSRWLSCTATPQIEEE |
| Protein accession: | AAH12906.1 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Applications: | ELISA |
| Shipping condition: | Dry Ice |