NUP98 monoclonal antibody (M01), clone 4G2 View larger

NUP98 monoclonal antibody (M01), clone 4G2

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of NUP98 monoclonal antibody (M01), clone 4G2

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsELISA

More info about NUP98 monoclonal antibody (M01), clone 4G2

Brand: Abnova
Reference: H00004928-M01
Product name: NUP98 monoclonal antibody (M01), clone 4G2
Product description: Mouse monoclonal antibody raised against a partial recombinant NUP98.
Clone: 4G2
Isotype: IgG2a Kappa
Gene id: 4928
Gene name: NUP98
Gene alias: ADIR2|NUP196|NUP96
Gene description: nucleoporin 98kDa
Genbank accession: BC012906.1
Immunogen: NUP98 (AAH12906.1, 1 a.a. ~ 110 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: MKLYQTPLELKLKHSTVHVDELCPLIVPNLGVAVIHDYADWVKEASGDLPEAQIVKHWSLTWTLCEALWGHLKELDSQLNEPREYIQILERRRAFSRWLSCTATPQIEEE
Protein accession: AAH12906.1
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Applications: ELISA
Shipping condition: Dry Ice

Reviews

Buy NUP98 monoclonal antibody (M01), clone 4G2 now

Add to cart