Brand: | Abnova |
Reference: | H00004926-M01 |
Product name: | NUMA1 monoclonal antibody (M01), clone 1C5 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant NUMA1. |
Clone: | 1C5 |
Isotype: | IgG1 Kappa |
Gene id: | 4926 |
Gene name: | NUMA1 |
Gene alias: | NUMA |
Gene description: | nuclear mitotic apparatus protein 1 |
Genbank accession: | NM_006185 |
Immunogen: | NUMA1 (NP_006176, 200 a.a. ~ 306 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | SPASPMGDILQTPQFQMRRLKKQLADERSNRDELELELAENRKLLTEKDAQIAMMQQRIDRLALLNEKQAASPLEPKELEELRDKNESLTMRLHETLKQCQDLKTEK |
Protein accession: | NP_006176 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (37.51 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: |  |
Application image note: | NUMA1 monoclonal antibody (M01), clone 1C5 Western Blot analysis of NUMA1 expression in K-562 ( Cat # L009V1 ). |
Applications: | WB-Ce,S-ELISA,ELISA,WB-Re,IP |
Shipping condition: | Dry Ice |