Brand: | Abnova |
Reference: | H00004925-M03 |
Product name: | NUCB2 monoclonal antibody (M03), clone 6H4 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant NUCB2. |
Clone: | 6H4 |
Isotype: | IgG2a Kappa |
Gene id: | 4925 |
Gene name: | NUCB2 |
Gene alias: | NEFA |
Gene description: | nucleobindin 2 |
Genbank accession: | NM_005013 |
Immunogen: | NUCB2 (NP_005004.1, 322 a.a. ~ 420 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | TEKKEFLEPDSWETLDQQQFFTEEELKEYENIIALQENELKKKADELQKQKEELQRQHDQLEAQKLEYHQVIQQMEQKKLQQGIPPSGPAGELKFEPHI |
Protein accession: | NP_005004.1 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (36.63 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: |  |
Application image note: | NUCB2 monoclonal antibody (M03), clone 6H4. Western Blot analysis of NUCB2 expression in HepG2. |
Applications: | WB-Ce,IF,S-ELISA,ELISA,WB-Re |
Shipping condition: | Dry Ice |