No products
Prices are tax excluded
Brand | Abnova |
Product type | Primary antibodies |
Reactivity | Human |
Host species | Mouse |
Applications | ELISA |
Brand: | Abnova |
Reference: | H00004922-M03 |
Product name: | NTS monoclonal antibody (M03), clone 1G8 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant NTS. |
Clone: | 1G8 |
Isotype: | IgG2b Kappa |
Gene id: | 4922 |
Gene name: | NTS |
Gene alias: | NMN-125|NN|NT|NT/N|NTS1 |
Gene description: | neurotensin |
Genbank accession: | BC010918 |
Immunogen: | NTS (AAH10918, 71 a.a. ~ 170 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | PAEETGEVHEEELVARRKLPTALDGFSLEAMLTIYQLHKICHSRAFQHWELIQEDILDTGNDKNGKEEVIKRKIPYILKRQLYENKPRRPYILKRDSYYY |
Protein accession: | AAH10918 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Applications: | ELISA |
Shipping condition: | Dry Ice |