ROR2 monoclonal antibody (M04), clone 4B8 View larger

ROR2 monoclonal antibody (M04), clone 4B8

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of ROR2 monoclonal antibody (M04), clone 4B8

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsS-ELISA,ELISA

More info about ROR2 monoclonal antibody (M04), clone 4B8

Brand: Abnova
Reference: H00004920-M04
Product name: ROR2 monoclonal antibody (M04), clone 4B8
Product description: Mouse monoclonal antibody raised against a partial recombinant ROR2.
Clone: 4B8
Isotype: IgG2b Kappa
Gene id: 4920
Gene name: ROR2
Gene alias: BDB|BDB1|MGC163394|NTRKR2
Gene description: receptor tyrosine kinase-like orphan receptor 2
Genbank accession: NM_004560
Immunogen: ROR2 (NP_004551, 34 a.a. ~ 143 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: EVEVLDPNDPLGPLDGQDGPIPTLKGYFLNFLEPVNNITIVQGQTAILHCKVAGNPPPNVRWLKNDAPVVQEPRRIIIRKTEYGSRLRIQDLDTTDTGYYQCVATNGMKT
Protein accession: NP_004551
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00004920-M04-9-18-1.jpg
Application image note: Detection limit for recombinant GST tagged ROR2 is approximately 3ng/ml as a capture antibody.
Applications: S-ELISA,ELISA
Shipping condition: Dry Ice

Reviews

Buy ROR2 monoclonal antibody (M04), clone 4B8 now

Add to cart