| Brand: | Abnova |
| Reference: | H00004920-M04 |
| Product name: | ROR2 monoclonal antibody (M04), clone 4B8 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant ROR2. |
| Clone: | 4B8 |
| Isotype: | IgG2b Kappa |
| Gene id: | 4920 |
| Gene name: | ROR2 |
| Gene alias: | BDB|BDB1|MGC163394|NTRKR2 |
| Gene description: | receptor tyrosine kinase-like orphan receptor 2 |
| Genbank accession: | NM_004560 |
| Immunogen: | ROR2 (NP_004551, 34 a.a. ~ 143 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | EVEVLDPNDPLGPLDGQDGPIPTLKGYFLNFLEPVNNITIVQGQTAILHCKVAGNPPPNVRWLKNDAPVVQEPRRIIIRKTEYGSRLRIQDLDTTDTGYYQCVATNGMKT |
| Protein accession: | NP_004551 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | Detection limit for recombinant GST tagged ROR2 is approximately 3ng/ml as a capture antibody. |
| Applications: | S-ELISA,ELISA |
| Shipping condition: | Dry Ice |