Brand: | Abnova |
Reference: | H00004919-M02 |
Product name: | ROR1 monoclonal antibody (M02), clone 1B4 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant ROR1. |
Clone: | 1B4 |
Isotype: | IgG1 Kappa |
Gene id: | 4919 |
Gene name: | ROR1 |
Gene alias: | MGC99659|NTRKR1|dJ537F10.1 |
Gene description: | receptor tyrosine kinase-like orphan receptor 1 |
Genbank accession: | BC006374 |
Immunogen: | ROR1 (-, 294 a.a. ~ 393 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | ANCIRIGIPMADPINKNHKCYNSTGVDYRGTVSVTKSGRQCQPWNSQYPHTHTFTALRFPELNGGHSYCRNPGNQKEAPWCFTLDENFKSDLCDIPACGK |
Protein accession: | - |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (36.63 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: |  |
Application image note: | Detection limit for recombinant GST tagged ROR1 is 1 ng/ml as a capture antibody. |
Applications: | WB-Ce,S-ELISA,ELISA,WB-Re |
Shipping condition: | Dry Ice |