| Brand: | Abnova |
| Reference: | H00004907-M02 |
| Product name: | NT5E monoclonal antibody (M02), clone 4D3-2C10 |
| Product description: | Mouse monoclonal antibody raised against a full-length recombinant NT5E. |
| Clone: | 4D3-2C10 |
| Isotype: | IgG1 Kappa |
| Gene id: | 4907 |
| Gene name: | NT5E |
| Gene alias: | CD73|E5NT|NT|NT5|NTE|eN|eNT |
| Gene description: | 5'-nucleotidase, ecto (CD73) |
| Genbank accession: | BC015940 |
| Immunogen: | NT5E (AAH15940.1, 28 a.a. ~ 264 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | ELTILHTNDVHSRLEQTSEDSSKCVNASRCMGGVARLFTKVQQIRRAEPNVLLLDAGDQYQGTIWFTVYKGAEVAHFMNALRYDAMALGNHEFDNGVEGLIEPLLKEAKFPILSANIKAKGPLASQISGLYLPYKVLPVGDEVVGIVGYTSKETPFLSNPGTNLVFEDEITALQPEVDKLKTLNVNKIIALGHSGSEMDKLIAQKVRGVDVVVGGHSNTFLYTGNCFKRIAWARMSR |
| Protein accession: | AAH15940.1 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (51.81 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | Detection limit for recombinant GST tagged NT5E is 0.3 ng/ml as a capture antibody. |
| Applications: | S-ELISA,ELISA,WB-Re |
| Shipping condition: | Dry Ice |