| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | ELISA,WB-Re,WB-Tr |
| Brand: | Abnova |
| Reference: | H00004907-M01 |
| Product name: | NT5E monoclonal antibody (M01), clone 4C4-2B5 |
| Product description: | Mouse monoclonal antibody raised against a full length recombinant NT5E. |
| Clone: | 4C4-2B5 |
| Isotype: | IgG1 kappa |
| Gene id: | 4907 |
| Gene name: | NT5E |
| Gene alias: | CD73|E5NT|NT|NT5|NTE|eN|eNT |
| Gene description: | 5'-nucleotidase, ecto (CD73) |
| Genbank accession: | BC015940 |
| Immunogen: | NT5E (AAH15940.1, 28 a.a. ~ 264 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | ELTILHTNDVHSRLEQTSEDSSKCVNASRCMGGVARLFTKVQQIRRAEPNVLLLDAGDQYQGTIWFTVYKGAEVAHFMNALRYDAMALGNHEFDNGVEGLIEPLLKEAKFPILSANIKAKGPLASQISGLYLPYKVLPVGDEVVGIVGYTSKETPFLSNPGTNLVFEDEITALQPEVDKLKTLNVNKIIALGHSGSEMDKLIAQKVRGVDVVVGGHSNTFLYTGNCFKRIAWARMSR |
| Protein accession: | AAH15940.1 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: | ![]() |
| Quality control testing picture note: | Western Blot detection against Immunogen (51.81 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: | ![]() |
| Application image note: | Western Blot analysis of NT5E expression in transfected 293T cell line by NT5E monoclonal antibody (M01), clone 4C4-2B5. Lane 1: NT5E transfected lysate(30.36 KDa). Lane 2: Non-transfected lysate. |
| Applications: | ELISA,WB-Re,WB-Tr |
| Shipping condition: | Dry Ice |
| Publications: | Targeted identification of sialo-glycoproteins in hypoxic endothelial cells and validation in zebrafish reveals roles for proteins in angiogenesis.Delcourt N, Quevedo C, Nonne C, Fons P, O'Brien D, Loyaux D, Diez M, Autelitano F, Guillemot JC, Ferrara P, Muriana A, Callol C, Herault JP, Herbert JM, Favre G, Bono F. J Biol Chem. 2014 Nov 10. pii: jbc.M114.618611. |