YBX1 monoclonal antibody (M02), clone 4C7 View larger

YBX1 monoclonal antibody (M02), clone 4C7

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of YBX1 monoclonal antibody (M02), clone 4C7

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsIF,S-ELISA,ELISA,WB-Re

More info about YBX1 monoclonal antibody (M02), clone 4C7

Brand: Abnova
Reference: H00004904-M02
Product name: YBX1 monoclonal antibody (M02), clone 4C7
Product description: Mouse monoclonal antibody raised against a partial recombinant YBX1.
Clone: 4C7
Isotype: IgG2a Kappa
Gene id: 4904
Gene name: YBX1
Gene alias: BP-8|CSDA2|CSDB|DBPB|MDR-NF1|MGC104858|MGC110976|MGC117250|NSEP-1|NSEP1|YB-1|YB1
Gene description: Y box binding protein 1
Genbank accession: NM_004559
Immunogen: YBX1 (NP_004550, 51 a.a. ~ 139 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: DKKVIATKVLGTVKWFNVRNGYGFINRNDTKEDVFVHQTAIKKNNPRKYLRSVGDGETVEFDVVEGEKGAEAANVTGPGGVPVQGSKYA
Protein accession: NP_004550
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00004904-M02-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (35.53 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00004904-M02-9-21-1.jpg
Application image note: Detection limit for recombinant GST tagged YBX1 is approximately 0.1ng/ml as a capture antibody.
Applications: IF,S-ELISA,ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy YBX1 monoclonal antibody (M02), clone 4C7 now

Add to cart