Brand: | Abnova |
Reference: | H00004899-M01 |
Product name: | NRF1 monoclonal antibody (M01), clone 2F9 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant NRF1. |
Clone: | 2F9 |
Isotype: | IgG1 Kappa |
Gene id: | 4899 |
Gene name: | NRF1 |
Gene alias: | ALPHA-PAL |
Gene description: | nuclear respiratory factor 1 |
Genbank accession: | NM_005011 |
Immunogen: | NRF1 (NP_005002, 201 a.a. ~ 285 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | TQAQLRAFIPEMLKYSTGRGKPGWGKESCKPIWWPEDIPWANVRSDVRTEEQKQRVSWTQALRTIVKNCYKQHGREDLLYAFEDQ |
Protein accession: | NP_005002 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (35.09 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: |  |
Application image note: | NRF1 monoclonal antibody (M01), clone 2F9. Western Blot analysis of NRF1 expression in human Skeletal muscle. |
Applications: | WB-Ce,WB-Ti,IHC-P,S-ELISA,ELISA,WB-Re,WB-Tr,RNAi-Ab |
Shipping condition: | Dry Ice |
Publications: | Decreased expression of BRCA1 in SK-BR-3 cells is the result of aberrant activation of the GABP Beta promoter by an NRF-1-containing complex.Thompson C, Macdonald G, Mueller CR. Mol Cancer. 2011 May 24;10(1):62. [Epub ahead of print] |