Cart 2 Product Products 651,00 € (empty)
No products
To be determined Shipping
651,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 2 items in your cart. There is 1 item in your cart.
Total products (tax excl.) 651,00 €
Total shipping (tax excl.) To be determined
Total (tax excl.) 651,00 €
Data sheet of NRAS monoclonal antibody (M01), clone 2A3
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | S-ELISA,ELISA,WB-Re |
More info about NRAS monoclonal antibody (M01), clone 2A3
| Brand: | Abnova |
| Reference: | H00004893-M01 |
| Product name: | NRAS monoclonal antibody (M01), clone 2A3 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant NRAS. |
| Clone: | 2A3 |
| Isotype: | IgG1 Kappa |
| Gene id: | 4893 |
| Gene name: | NRAS |
| Gene alias: | ALPS4|N-ras|NRAS1 |
| Gene description: | neuroblastoma RAS viral (v-ras) oncogene homolog |
| Genbank accession: | BC005219 |
| Immunogen: | NRAS (AAH05219, 90 a.a. ~ 189 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | FADINLYREQIKRVKDSDDVPMVLVGNKCDLPTRTVDTKQAHELAKSYGIPFIETSAKTRQGVEDAFYTLVREIRQYRMKKLNSSDDGTQGCMGLPCVVM |
| Protein accession: | AAH05219 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (36.63 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | Detection limit for recombinant GST tagged NRAS is approximately 0.1ng/ml as a capture antibody. |
| Applications: | S-ELISA,ELISA,WB-Re |
| Shipping condition: | Dry Ice |