NRAP monoclonal antibody (M01), clone 1E9 View larger

NRAP monoclonal antibody (M01), clone 1E9

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of NRAP monoclonal antibody (M01), clone 1E9

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsS-ELISA,ELISA,WB-Re

More info about NRAP monoclonal antibody (M01), clone 1E9

Brand: Abnova
Reference: H00004892-M01
Product name: NRAP monoclonal antibody (M01), clone 1E9
Product description: Mouse monoclonal antibody raised against a partial recombinant NRAP.
Clone: 1E9
Isotype: IgG2a Kappa
Gene id: 4892
Gene name: NRAP
Gene alias: -
Gene description: nebulin-related anchoring protein
Genbank accession: NM_198060
Immunogen: NRAP (NP_932326.2, 1640 a.a. ~ 1727 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: LRHAQKAHQLQSDVKYKSDLNLTRGVGWTPPGSYKVEMARRAAELANARGLGLQGAYRGAEAVEAGDHQSGEVNPDATEILHVKKKKA
Protein accession: NP_932326.2
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00004892-M01-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (35.42 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00004892-M01-9-21-1.jpg
Application image note: Detection limit for recombinant GST tagged NRAP is 0.1 ng/ml as a capture antibody.
Applications: S-ELISA,ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy NRAP monoclonal antibody (M01), clone 1E9 now

Add to cart