SLC11A2 monoclonal antibody (M06), clone 2F7 View larger

SLC11A2 monoclonal antibody (M06), clone 2F7

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of SLC11A2 monoclonal antibody (M06), clone 2F7

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsS-ELISA,ELISA,WB-Re

More info about SLC11A2 monoclonal antibody (M06), clone 2F7

Brand: Abnova
Reference: H00004891-M06
Product name: SLC11A2 monoclonal antibody (M06), clone 2F7
Product description: Mouse monoclonal antibody raised against a partial recombinant SLC11A2.
Clone: 2F7
Isotype: IgG2a Kappa
Gene id: 4891
Gene name: SLC11A2
Gene alias: DCT1|DMT1|FLJ37416|NRAMP2
Gene description: solute carrier family 11 (proton-coupled divalent metal ion transporters), member 2
Genbank accession: NM_000617
Immunogen: SLC11A2 (NP_000608, 1 a.a. ~ 65 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: MVLGPEQKMSDDSVSGDHGESASLGNINPAYSNPSLSQSPGDSEEYFATYFNEKISIPEEEYSCF
Protein accession: NP_000608
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00004891-M06-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (32.89 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00004891-M06-9-22-1.jpg
Application image note: Detection limit for recombinant GST tagged SLC11A2 is approximately 0.03ng/ml as a capture antibody.
Applications: S-ELISA,ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy SLC11A2 monoclonal antibody (M06), clone 2F7 now

Add to cart