Brand: | Abnova |
Reference: | H00004891-M05 |
Product name: | SLC11A2 monoclonal antibody (M05), clone 2F11 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant SLC11A2. |
Clone: | 2F11 |
Isotype: | IgG2a Kappa |
Gene id: | 4891 |
Gene name: | SLC11A2 |
Gene alias: | DCT1|DMT1|FLJ37416|NRAMP2 |
Gene description: | solute carrier family 11 (proton-coupled divalent metal ion transporters), member 2 |
Genbank accession: | NM_000617 |
Immunogen: | SLC11A2 (NP_000608, 1 a.a. ~ 65 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | MVLGPEQKMSDDSVSGDHGESASLGNINPAYSNPSLSQSPGDSEEYFATYFNEKISIPEEEYSCF |
Protein accession: | NP_000608 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (32.89 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: |  |
Application image note: | Detection limit for recombinant GST tagged SLC11A2 is approximately 0.03ng/ml as a capture antibody. |
Applications: | S-ELISA,ELISA,WB-Re |
Shipping condition: | Dry Ice |