| Brand: | Abnova |
| Reference: | H00004891-M05 |
| Product name: | SLC11A2 monoclonal antibody (M05), clone 2F11 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant SLC11A2. |
| Clone: | 2F11 |
| Isotype: | IgG2a Kappa |
| Gene id: | 4891 |
| Gene name: | SLC11A2 |
| Gene alias: | DCT1|DMT1|FLJ37416|NRAMP2 |
| Gene description: | solute carrier family 11 (proton-coupled divalent metal ion transporters), member 2 |
| Genbank accession: | NM_000617 |
| Immunogen: | SLC11A2 (NP_000608, 1 a.a. ~ 65 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | MVLGPEQKMSDDSVSGDHGESASLGNINPAYSNPSLSQSPGDSEEYFATYFNEKISIPEEEYSCF |
| Protein accession: | NP_000608 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (32.89 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | Detection limit for recombinant GST tagged SLC11A2 is approximately 0.03ng/ml as a capture antibody. |
| Applications: | S-ELISA,ELISA,WB-Re |
| Shipping condition: | Dry Ice |