Brand: | Abnova |
Reference: | H00004886-M03 |
Product name: | NPY1R monoclonal antibody (M03), clone 2G2 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant NPY1R. |
Clone: | 2G2 |
Isotype: | IgG2a Kappa |
Gene id: | 4886 |
Gene name: | NPY1R |
Gene alias: | NPYR |
Gene description: | neuropeptide Y receptor Y1 |
Genbank accession: | BC036657 |
Immunogen: | NPY1R (AAH36657, 1 a.a. ~ 115 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | MNSTLFSQVENHSVHSNFSEKNAQLLAFENDDCHLPLAMIFTLALAYGAVIILGVSGNLALIIIILKQKEMRNVTNILIVNLSFSDLLVAIMCLPFTFVYTLMDHWVFGEAMCKL |
Protein accession: | AAH36657 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (38.39 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: |  |
Application image note: | Detection limit for recombinant GST tagged NPY1R is approximately 0.1ng/ml as a capture antibody. |
Applications: | S-ELISA,ELISA,WB-Re |
Shipping condition: | Dry Ice |
Publications: | Neuropeptide Y and Neuropeptide Y Y5 Receptor Interaction Restores Impaired Growth Potential of Aging Bone Marrow Stromal Cells.Igura K, Haider HK, Ahmed RP, Sheriff S, Ashraf M. Rejuvenation Res. 2011 May 19. [Epub ahead of print] |