NPTX1 monoclonal antibody (M06), clone 7E6 View larger

NPTX1 monoclonal antibody (M06), clone 7E6

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of NPTX1 monoclonal antibody (M06), clone 7E6

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsS-ELISA,ELISA,WB-Re,WB-Tr

More info about NPTX1 monoclonal antibody (M06), clone 7E6

Brand: Abnova
Reference: H00004884-M06
Product name: NPTX1 monoclonal antibody (M06), clone 7E6
Product description: Mouse monoclonal antibody raised against a partial recombinant NPTX1.
Clone: 7E6
Isotype: IgG2b Kappa
Gene id: 4884
Gene name: NPTX1
Gene alias: DKFZp686J2446|MGC105123|NP1
Gene description: neuronal pentraxin I
Genbank accession: NM_002522
Immunogen: NPTX1 (NP_002513.2, 141 a.a. ~ 240 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: KTRLENLEQYSRLNSSSQTNSLKDLLQSKIDELERQVLSRVNTLEEGKGGPRNDTEERVKIETALTSLHQRISELEKGQKDNRPGDKFQLTFPLRTNYMY
Protein accession: NP_002513.2
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00004884-M06-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (36.74 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00004884-M06-13-15-1.jpg
Application image note: Western Blot analysis of NPTX1 expression in transfected 293T cell line by NPTX1 monoclonal antibody (M06), clone 7E6.

Lane 1: NPTX1 transfected lysate (Predicted MW: 47.52 KDa).
Lane 2: Non-transfected lysate.
Applications: S-ELISA,ELISA,WB-Re,WB-Tr
Shipping condition: Dry Ice

Reviews

Buy NPTX1 monoclonal antibody (M06), clone 7E6 now

Add to cart