Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of NPPB monoclonal antibody (M01), clone 2D11
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | S-ELISA,ELISA,WB-Re,WB-Tr,IP |
More info about NPPB monoclonal antibody (M01), clone 2D11
| Brand: | Abnova |
| Reference: | H00004879-M01 |
| Product name: | NPPB monoclonal antibody (M01), clone 2D11 |
| Product description: | Mouse monoclonal antibody raised against a full length recombinant NPPB. |
| Clone: | 2D11 |
| Isotype: | IgG3 Kappa |
| Gene id: | 4879 |
| Gene name: | NPPB |
| Gene alias: | BNP |
| Gene description: | natriuretic peptide precursor B |
| Genbank accession: | BC025785 |
| Immunogen: | NPPB (AAH25785, 1 a.a. ~ 134 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | MDPQTAPSRALLLLLFLHLAFLGGRSHPLGSPGSASDSETSGLQEQRNHLQGKLSELQVEQTSLEPLQESPRPTGVWKSREVATEGIRGHRKMVLYTLRAPRSPKMVQGSGCFGRKMDRISSSSGLGCKVLRRH |
| Protein accession: | AAH25785 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (40.48 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | Western Blot analysis of NPPB expression in transfected 293T cell line by NPPB monoclonal antibody (M01), clone 2D11. Lane 1: NPPB transfected lysate(14.726 KDa). Lane 2: Non-transfected lysate. |
| Applications: | S-ELISA,ELISA,WB-Re,WB-Tr,IP |
| Shipping condition: | Dry Ice |
| Publications: | The arrhythmogenic effect of self-assembling nanopeptide hydrogel scaffolds on neonatal mouse cardiomyocytes.Chiu YW, Chen WP, Su CC, Lee YC, Hsieh PH, Ho YL Nanomedicine. 2014 Jan 31. pii: S1549-9634(14)00029-X. doi: 10.1016/j.nano.2014.01.005. |